Lineage for d3vunc_ (3vun C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776120Species Influenza A virus [TaxId:387139] [256143] (1 PDB entry)
  8. 2776122Domain d3vunc_: 3vun C: [250691]
    Other proteins in same PDB: d3vunb_, d3vund_, d3vunf_
    automated match to d2hmga_
    complexed with nag

Details for d3vunc_

PDB Entry: 3vun (more details), 3 Å

PDB Description: crystal structure of a influenza a virus (a/aichi/2/1968 h3n2) hemagglutinin in c2 space group.
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3vunc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vunc_ b.19.1.2 (C:) automated matches {Influenza A virus [TaxId: 387139]}
dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
kyvkqntlklatgmrnvpe

SCOPe Domain Coordinates for d3vunc_:

Click to download the PDB-style file with coordinates for d3vunc_.
(The format of our PDB-style files is described here.)

Timeline for d3vunc_: