Lineage for d3vuna_ (3vun A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385789Species Influenza A virus [TaxId:387139] [256143] (1 PDB entry)
  8. 2385790Domain d3vuna_: 3vun A: [250689]
    Other proteins in same PDB: d3vunb_, d3vund_, d3vunf_
    automated match to d2hmga_
    complexed with nag

Details for d3vuna_

PDB Entry: 3vun (more details), 3 Å

PDB Description: crystal structure of a influenza a virus (a/aichi/2/1968 h3n2) hemagglutinin in c2 space group.
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3vuna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vuna_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 387139]}
dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl
idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft
wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps
tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin
sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp
kyvkqntlklatgmrnvpe

SCOPe Domain Coordinates for d3vuna_:

Click to download the PDB-style file with coordinates for d3vuna_.
(The format of our PDB-style files is described here.)

Timeline for d3vuna_: