Lineage for d3vuad_ (3vua D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766861Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)
  8. 2766876Domain d3vuad_: 3vua D: [250686]
    automated match to d3rtlb_
    complexed with act, gol, so4

Details for d3vuad_

PDB Entry: 3vua (more details), 1.85 Å

PDB Description: apo isdh-neat3 in space group p3121 at a resolution of 1.85 a
PDB Compounds: (D:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3vuad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vuad_ b.1.28.0 (D:) automated matches {Staphylococcus aureus [TaxId: 158879]}
qltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdlivegk
rvttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdin

SCOPe Domain Coordinates for d3vuad_:

Click to download the PDB-style file with coordinates for d3vuad_.
(The format of our PDB-style files is described here.)

Timeline for d3vuad_: