| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) ![]() |
| Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
| Protein automated matches [195426] (7 species) not a true protein |
| Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries) |
| Domain d3vuab_: 3vua B: [250684] automated match to d3rtlb_ complexed with act, gol, so4 |
PDB Entry: 3vua (more details), 1.85 Å
SCOPe Domain Sequences for d3vuab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vuab_ b.1.28.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
qltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdlivegk
rvttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdin
Timeline for d3vuab_: