SCOPe 2.08: Domain d3vtmb_: 3vtm B:

Lineage for d3vtmb_ (3vtm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.0: automated matches [195425] (1 protein)
   not a true family

6. Protein automated matches [195426] (7 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)

8. Domain d3vtmb_: 3vtm B: [250679]
   automated match to d3rtlb_
   complexed with 3zz, gol

Details for d3vtmb_

PDB Entry: 3vtm, 2.8 Å

PDB Description: structure of heme transport protein isdh-neat3 from s. aureus in complex with indium-porphyrin

PDB Compounds: (B:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3vtmb_:

Sequence; same for both SEQRES and ATOM records:

>d3vtmb_ b.1.28.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158879]}
qltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdlivegk
rvttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdi

Timeline for d3vtmb_:

• d3vtmb_ first appeared in SCOPe 2.04
  
• d3vtmb_ appears in SCOPe 2.07