Lineage for d3vtma_ (3vtm A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766861Species Staphylococcus aureus [TaxId:158879] [233500] (8 PDB entries)
  8. 2766882Domain d3vtma_: 3vtm A: [250678]
    automated match to d3rtlb_
    complexed with 3zz, gol

Details for d3vtma_

PDB Entry: 3vtm (more details), 2.8 Å

PDB Description: structure of heme transport protein isdh-neat3 from s. aureus in complex with indium-porphyrin
PDB Compounds: (A:) Iron-regulated surface determinant protein H

SCOPe Domain Sequences for d3vtma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vtma_ b.1.28.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
qltdlqeahfvvfeseensesvmdgfvehpfytatlngqkyvvmktkddsywkdlivegk
rvttvskdpknnsrtlifpyipdkavynaivkvvvanigyegqyhvriinqdi

SCOPe Domain Coordinates for d3vtma_:

Click to download the PDB-style file with coordinates for d3vtma_.
(The format of our PDB-style files is described here.)

Timeline for d3vtma_: