Lineage for d3vs7b3 (3vs7 B:250-531)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588133Protein Haemopoetic cell kinase Hck [56151] (1 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2588134Species Human (Homo sapiens) [TaxId:9606] [56152] (24 PDB entries)
  8. 2588165Domain d3vs7b3: 3vs7 B:250-531 [250675]
    Other proteins in same PDB: d3vs7a1, d3vs7a2, d3vs7a4, d3vs7b1, d3vs7b2, d3vs7b4
    automated match to d1fmka3
    complexed with ca, cl, ks1

Details for d3vs7b3

PDB Entry: 3vs7 (more details), 3 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor 1-cyclopentyl-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs7b3:

Sequence, based on SEQRES records: (download)

>d3vs7b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt
apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe
elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip

Sequence, based on observed residues (ATOM records): (download)

>d3vs7b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla
eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq
iaegmafieqrnyihrdlraanilvsaslvckiadfglarpikwtapeainfgsftiksd
vwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpe
erptfeyiqsvlddfytatesqyeeip

SCOPe Domain Coordinates for d3vs7b3:

Click to download the PDB-style file with coordinates for d3vs7b3.
(The format of our PDB-style files is described here.)

Timeline for d3vs7b3: