Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Haemopoetic cell kinase Hck [56151] (1 species) PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56152] (19 PDB entries) |
Domain d3vs7b3: 3vs7 B:250-531 [250675] Other proteins in same PDB: d3vs7a1, d3vs7a2, d3vs7b1, d3vs7b2 automated match to d1fmka3 complexed with ca, cl, ks1 |
PDB Entry: 3vs7 (more details), 3 Å
SCOPe Domain Sequences for d3vs7b3:
Sequence, based on SEQRES records: (download)
>d3vs7b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwt apeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpe elynimmrcwknrpeerptfeyiqsvlddfytatesqyeeip
>d3vs7b3 d.144.1.7 (B:250-531) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} kpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveafla eanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaq iaegmafieqrnyihrdlraanilvsaslvckiadfglarpikwtapeainfgsftiksd vwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwknrpe erptfeyiqsvlddfytatesqyeeip
Timeline for d3vs7b3: