Lineage for d3vs7b1 (3vs7 B:86-146)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393062Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries)
  8. 2393164Domain d3vs7b1: 3vs7 B:86-146 [250673]
    Other proteins in same PDB: d3vs7a2, d3vs7a3, d3vs7a4, d3vs7b2, d3vs7b3, d3vs7b4
    automated match to d1fmka1
    complexed with ca, cl, ks1

Details for d3vs7b1

PDB Entry: 3vs7 (more details), 3 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor 1-cyclopentyl-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs7b1 b.34.2.0 (B:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d3vs7b1:

Click to download the PDB-style file with coordinates for d3vs7b1.
(The format of our PDB-style files is described here.)

Timeline for d3vs7b1: