SCOPe 2.04: Domain d3vs7b1: 3vs7 B:85-146

Lineage for d3vs7b1 (3vs7 B:85-146)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (77 PDB entries)

8. Domain d3vs7b1: 3vs7 B:85-146 [250673]
   Other proteins in same PDB: d3vs7a2, d3vs7a3, d3vs7b2, d3vs7b3
   automated match to d1fmka1
   complexed with ca, cl, ks1

Details for d3vs7b1

PDB Entry: 3vs7, 3 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor 1-cyclopentyl-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine

PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs7b1:

Sequence; same for both SEQRES and ATOM records:

>d3vs7b1 b.34.2.0 (B:85-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
riivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsl
et

Timeline for d3vs7b1:

• d3vs7b1 is new in SCOPe 2.04-stable
  
• d3vs7b1 appears in SCOPe 2.05
  
• d3vs7b1 appears in the current release, SCOPe 2.08