![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
![]() | Protein automated matches [190457] (10 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
![]() | Domain d3vs7b1: 3vs7 B:86-146 [250673] Other proteins in same PDB: d3vs7a2, d3vs7a3, d3vs7a4, d3vs7b2, d3vs7b3, d3vs7b4 automated match to d1fmka1 complexed with ca, cl, ks1 |
PDB Entry: 3vs7 (more details), 3 Å
SCOPe Domain Sequences for d3vs7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs7b1 b.34.2.0 (B:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]} iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle t
Timeline for d3vs7b1:
![]() Domains from other chains: (mouse over for more information) d3vs7a1, d3vs7a2, d3vs7a3, d3vs7a4 |