Lineage for d3vs7a2 (3vs7 A:147-249)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965840Domain d3vs7a2: 3vs7 A:147-249 [250671]
    Other proteins in same PDB: d3vs7a1, d3vs7a3, d3vs7a4, d3vs7b1, d3vs7b3, d3vs7b4
    automated match to d1fmka2
    complexed with ca, cl, ks1

Details for d3vs7a2

PDB Entry: 3vs7 (more details), 3 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor 1-cyclopentyl-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs7a2 d.93.1.0 (A:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir
tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss

SCOPe Domain Coordinates for d3vs7a2:

Click to download the PDB-style file with coordinates for d3vs7a2.
(The format of our PDB-style files is described here.)

Timeline for d3vs7a2: