Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d3vs7a2: 3vs7 A:147-249 [250671] Other proteins in same PDB: d3vs7a1, d3vs7a3, d3vs7a4, d3vs7b1, d3vs7b3, d3vs7b4 automated match to d1fmka2 complexed with ca, cl, ks1 |
PDB Entry: 3vs7 (more details), 3 Å
SCOPe Domain Sequences for d3vs7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs7a2 d.93.1.0 (A:147-249) automated matches {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d3vs7a2:
View in 3D Domains from other chains: (mouse over for more information) d3vs7b1, d3vs7b2, d3vs7b3, d3vs7b4 |