| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187598] (102 PDB entries) |
| Domain d3vs7a1: 3vs7 A:86-146 [250670] Other proteins in same PDB: d3vs7a2, d3vs7a3, d3vs7a4, d3vs7b2, d3vs7b3, d3vs7b4 automated match to d1fmka1 complexed with ca, cl, ks1 |
PDB Entry: 3vs7 (more details), 3 Å
SCOPe Domain Sequences for d3vs7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vs7a1 b.34.2.0 (A:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t
Timeline for d3vs7a1:
View in 3DDomains from other chains: (mouse over for more information) d3vs7b1, d3vs7b2, d3vs7b3, d3vs7b4 |