Lineage for d3vs7a1 (3vs7 A:86-146)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783540Domain d3vs7a1: 3vs7 A:86-146 [250670]
    Other proteins in same PDB: d3vs7a2, d3vs7a3, d3vs7a4, d3vs7b2, d3vs7b3, d3vs7b4
    automated match to d1fmka1
    complexed with ca, cl, ks1

Details for d3vs7a1

PDB Entry: 3vs7 (more details), 3 Å

PDB Description: Crystal structure of HCK complexed with a pyrazolo-pyrimidine inhibitor 1-cyclopentyl-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine
PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3vs7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vs7a1 b.34.2.0 (A:86-146) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvdsle
t

SCOPe Domain Coordinates for d3vs7a1:

Click to download the PDB-style file with coordinates for d3vs7a1.
(The format of our PDB-style files is described here.)

Timeline for d3vs7a1: