SCOP 1.71: Domain d1czwh_: 1czw H:

Lineage for d1czwh_ (1czw H:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.40: OB-fold [50198] (10 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)

8. Domain d1czwh_: 1czw H: [25067]

Details for d1czwh_

PDB Entry: 1czw, 2.5 Å

PDB Description: structure of the w34a mutant of shiga-like toxin i b subunit

SCOP Domain Sequences for d1czwh_:

Sequence; same for both SEQRES and ATOM records:

>d1czwh_ b.40.2.1 (H:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndddtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr

Timeline for d1czwh_:

• d1czwh_ first appeared (with stable ids) in SCOP 1.55
  
• d1czwh_ appears in SCOP 1.69
  
• d1czwh_ appears in SCOP 1.73
  
• d1czwh_ appears in the current release, SCOPe 2.08