| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
| Domain d3vrqb1: 3vrq B:148-233 [250668] Other proteins in same PDB: d3vrqa2, d3vrqa3, d3vrqb2, d3vrqb3 automated match to d3buxb1 complexed with ca; mutant |
PDB Entry: 3vrq (more details), 2.39 Å
SCOPe Domain Sequences for d3vrqb1:
Sequence, based on SEQRES records: (download)
>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myqltkapahtfwrescgarcvlpwaefesllgtchpvepgctalalrttidltcsghvs
ifefdvftrlfqpwptllknwqllav
>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myqltkapahtfwrescgarcvlpwaefesllgtchptalalrttidltcsghvsifefd
vftrlfqpwptllknwqllav
Timeline for d3vrqb1: