![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
![]() | Protein automated matches [190513] (36 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189519] (53 PDB entries) |
![]() | Domain d3vrqb1: 3vrq B:148-233 [250668] Other proteins in same PDB: d3vrqa2, d3vrqa3, d3vrqb2, d3vrqb3 automated match to d3buxb1 complexed with ca; mutant |
PDB Entry: 3vrq (more details), 2.39 Å
SCOPe Domain Sequences for d3vrqb1:
Sequence, based on SEQRES records: (download)
>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]} myqltkapahtfwrescgarcvlpwaefesllgtchpvepgctalalrttidltcsghvs ifefdvftrlfqpwptllknwqllav
>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]} myqltkapahtfwrescgarcvlpwaefesllgtchptalalrttidltcsghvsifefd vftrlfqpwptllknwqllav
Timeline for d3vrqb1: