Lineage for d3vrqb1 (3vrq B:148-233)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2320807Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2320808Protein automated matches [190513] (31 species)
    not a true protein
  7. 2320858Species Human (Homo sapiens) [TaxId:9606] [189519] (52 PDB entries)
  8. 2320877Domain d3vrqb1: 3vrq B:148-233 [250668]
    Other proteins in same PDB: d3vrqa2, d3vrqa3, d3vrqb2, d3vrqb3
    automated match to d3buxb1
    complexed with ca; mutant

Details for d3vrqb1

PDB Entry: 3vrq (more details), 2.39 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)
PDB Compounds: (B:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrqb1:

Sequence, based on SEQRES records: (download)

>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myqltkapahtfwrescgarcvlpwaefesllgtchpvepgctalalrttidltcsghvs
ifefdvftrlfqpwptllknwqllav

Sequence, based on observed residues (ATOM records): (download)

>d3vrqb1 a.39.1.0 (B:148-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
myqltkapahtfwrescgarcvlpwaefesllgtchptalalrttidltcsghvsifefd
vftrlfqpwptllknwqllav

SCOPe Domain Coordinates for d3vrqb1:

Click to download the PDB-style file with coordinates for d3vrqb1.
(The format of our PDB-style files is described here.)

Timeline for d3vrqb1: