Lineage for d3vrqa2 (3vrq A:234-320)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2571840Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2571841Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2572318Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2572319Protein automated matches [190561] (4 species)
    not a true protein
  7. 2572320Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries)
  8. 2572360Domain d3vrqa2: 3vrq A:234-320 [250667]
    Other proteins in same PDB: d3vrqa1, d3vrqa3, d3vrqb1, d3vrqb3
    automated match to d1b47a3
    complexed with ca; mutant

Details for d3vrqa2

PDB Entry: 3vrq (more details), 2.39 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)
PDB Compounds: (A:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrqa2 d.93.1.0 (A:234-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhpgymafltydevqerlqacrdkpgsyifrlsctrlgqwaigyvssdgsilqtipankp
lsqvllegqkdgfylypdgkthnpdlt

SCOPe Domain Coordinates for d3vrqa2:

Click to download the PDB-style file with coordinates for d3vrqa2.
(The format of our PDB-style files is described here.)

Timeline for d3vrqa2: