SCOPe 2.04: Domain d3vrqa2: 3vrq A:234-320

Lineage for d3vrqa2 (3vrq A:234-320)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)

8. Domain d3vrqa2: 3vrq A:234-320 [250667]
   Other proteins in same PDB: d3vrqa1, d3vrqb1
   automated match to d1b47a3
   complexed with ca; mutant

Details for d3vrqa2

PDB Entry: 3vrq, 2.39 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c (PL mutant)

PDB Compounds: (A:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrqa2:

Sequence; same for both SEQRES and ATOM records:

>d3vrqa2 d.93.1.0 (A:234-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhpgymafltydevqerlqacrdkpgsyifrlsctrlgqwaigyvssdgsilqtipankp
lsqvllegqkdgfylypdgkthnpdlt

Timeline for d3vrqa2:

• d3vrqa2 is new in SCOPe 2.04-stable
  
• d3vrqa2 appears in SCOPe 2.05
  
• d3vrqa2 appears in the current release, SCOPe 2.08