Lineage for d3vrna1 (3vrn A:12-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714567Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 2714593Family a.48.1.0: automated matches [254318] (1 protein)
    not a true family
  6. 2714594Protein automated matches [254729] (1 species)
    not a true protein
  7. 2714595Species Human (Homo sapiens) [TaxId:9606] [256135] (2 PDB entries)
  8. 2714596Domain d3vrna1: 3vrn A:12-147 [250663]
    Other proteins in same PDB: d3vrna2, d3vrna3
    automated match to d2cbla2
    complexed with ca

Details for d3vrna1

PDB Entry: 3vrn (more details), 1.64 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c
PDB Compounds: (A:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrna1:

Sequence, based on SEQRES records: (download)

>d3vrna1 a.48.1.0 (A:12-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
weearalgravrmlqrleeqcvdprlsvsppslrdllprtaqllrevahsrraaggggpg
gpggsgdflliylanleaksrqvaallpprgrrsandelfragsrlrrqlaklaiifshm
haelhalfpggkycgh

Sequence, based on observed residues (ATOM records): (download)

>d3vrna1 a.48.1.0 (A:12-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
weearalgravrmlqrleeqcvvsppslrdllprtaqllrevahsrraaggggpggpggs
gdflliylanleaksrqvaallppsrlrrqlaklaiifshmhaelhalfpggkycgh

SCOPe Domain Coordinates for d3vrna1:

Click to download the PDB-style file with coordinates for d3vrna1.
(The format of our PDB-style files is described here.)

Timeline for d3vrna1: