Lineage for d3vrbb2 (3vrb B:139-281)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689722Family a.1.2.0: automated matches [230426] (1 protein)
    not a true family
  6. 2689723Protein automated matches [230427] (2 species)
    not a true protein
  7. 2689728Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries)
  8. 2689739Domain d3vrbb2: 3vrb B:139-281 [250660]
    Other proteins in same PDB: d3vrbb1, d3vrbf1
    automated match to d1zoyb2
    complexed with eph, f3s, fad, fes, ftn, fum, hem, sf4

Details for d3vrbb2

PDB Entry: 3vrb (more details), 2.91 Å

PDB Description: mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
PDB Compounds: (B:) Iron-sulfur subunit of succinate dehydrogenase

SCOPe Domain Sequences for d3vrbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrbb2 a.1.2.0 (B:139-281) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpan

SCOPe Domain Coordinates for d3vrbb2:

Click to download the PDB-style file with coordinates for d3vrbb2.
(The format of our PDB-style files is described here.)

Timeline for d3vrbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vrbb1