Lineage for d3vrbb1 (3vrb B:33-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179555Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2179556Protein automated matches [191164] (21 species)
    not a true protein
  7. 2179611Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries)
  8. 2179622Domain d3vrbb1: 3vrb B:33-138 [250659]
    Other proteins in same PDB: d3vrbb2, d3vrbf2
    automated match to d1zoyb1
    complexed with eph, f3s, fad, fes, ftn, fum, hem, sf4

Details for d3vrbb1

PDB Entry: 3vrb (more details), 2.91 Å

PDB Description: mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
PDB Compounds: (B:) Iron-sulfur subunit of succinate dehydrogenase

SCOPe Domain Sequences for d3vrbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrbb1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

SCOPe Domain Coordinates for d3vrbb1:

Click to download the PDB-style file with coordinates for d3vrbb1.
(The format of our PDB-style files is described here.)

Timeline for d3vrbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vrbb2