| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
| Protein automated matches [191164] (24 species) not a true protein |
| Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries) |
| Domain d3vr9f1: 3vr9 F:33-138 [250657] Other proteins in same PDB: d3vr9b2, d3vr9f2 automated match to d1zoyb1 complexed with eph, f3s, fad, fes, ftn, hem, mli, sf4 |
PDB Entry: 3vr9 (more details), 3.01 Å
SCOPe Domain Sequences for d3vr9f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr9f1 d.15.4.0 (F:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd
Timeline for d3vr9f1: