SCOPe 2.05: Domain d3vr8f2: 3vr8 F:139-281

Lineage for d3vr8f2 (3vr8 F:139-281)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.0: automated matches [230426] (1 protein)
   not a true family

6. Protein automated matches [230427] (1 species)
   not a true protein

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (7 PDB entries)

8. Domain d3vr8f2: 3vr8 F:139-281 [250654]
   Other proteins in same PDB: d3vr8b1, d3vr8f1
   automated match to d1zoyb2
   complexed with eph, f3s, fad, fes, hem, mli, rqx, sf4

Details for d3vr8f2

PDB Entry: 3vr8, 2.81 Å

PDB Description: mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum

PDB Compounds: (F:) Iron-sulfur subunit of succinate dehydrogenase

SCOPe Domain Sequences for d3vr8f2:

Sequence; same for both SEQRES and ATOM records:

>d3vr8f2 a.1.2.0 (F:139-281) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpan

Timeline for d3vr8f2:

• d3vr8f2 first appeared in SCOPe 2.04
  
• d3vr8f2 appears in SCOPe 2.06
  
• d3vr8f2 appears in the current release, SCOPe 2.08