Lineage for d3vr8f1 (3vr8 F:33-138)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541309Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2541310Protein automated matches [191164] (24 species)
    not a true protein
  7. 2541388Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries)
  8. 2541396Domain d3vr8f1: 3vr8 F:33-138 [250653]
    Other proteins in same PDB: d3vr8b2, d3vr8f2
    automated match to d1zoyb1
    complexed with eph, f3s, fad, fes, hem, mli, rqx, sf4

Details for d3vr8f1

PDB Entry: 3vr8 (more details), 2.81 Å

PDB Description: mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
PDB Compounds: (F:) Iron-sulfur subunit of succinate dehydrogenase

SCOPe Domain Sequences for d3vr8f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr8f1 d.15.4.0 (F:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg
icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd

SCOPe Domain Coordinates for d3vr8f1:

Click to download the PDB-style file with coordinates for d3vr8f1.
(The format of our PDB-style files is described here.)

Timeline for d3vr8f1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vr8f2