Lineage for d3vr8b2 (3vr8 B:139-281)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2303053Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2303184Family a.1.2.0: automated matches [230426] (1 protein)
    not a true family
  6. 2303185Protein automated matches [230427] (2 species)
    not a true protein
  7. 2303190Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries)
  8. 2303197Domain d3vr8b2: 3vr8 B:139-281 [250652]
    Other proteins in same PDB: d3vr8b1, d3vr8f1
    automated match to d1zoyb2
    complexed with eph, f3s, fad, fes, hem, mli, rqx, sf4

Details for d3vr8b2

PDB Entry: 3vr8 (more details), 2.81 Å

PDB Description: mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
PDB Compounds: (B:) Iron-sulfur subunit of succinate dehydrogenase

SCOPe Domain Sequences for d3vr8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr8b2 a.1.2.0 (B:139-281) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpan

SCOPe Domain Coordinates for d3vr8b2:

Click to download the PDB-style file with coordinates for d3vr8b2.
(The format of our PDB-style files is described here.)

Timeline for d3vr8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3vr8b1