| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.0: automated matches [230426] (1 protein) not a true family |
| Protein automated matches [230427] (2 species) not a true protein |
| Species Pig roundworm (Ascaris suum) [TaxId:6253] [256142] (8 PDB entries) |
| Domain d3vr8b2: 3vr8 B:139-281 [250652] Other proteins in same PDB: d3vr8b1, d3vr8f1 automated match to d1zoyb2 complexed with eph, f3s, fad, fes, hem, mli, rqx, sf4 |
PDB Entry: 3vr8 (more details), 2.81 Å
SCOPe Domain Sequences for d3vr8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr8b2 a.1.2.0 (B:139-281) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]}
mnlfyaqyasiqpwlqkktkinlgekqqyqsikeqekldglyecilcaccsascpsywwn
adkylgpavlmqayrwiidsrddsaaerlarmqdgfsafkchtimnctktcpkhlnpara
igeikmlltkmktkpaplptpan
Timeline for d3vr8b2: