![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Pig roundworm (Ascaris suum) [TaxId:6253] [256141] (8 PDB entries) |
![]() | Domain d3vr8b1: 3vr8 B:33-138 [250651] Other proteins in same PDB: d3vr8b2, d3vr8f2 automated match to d1zoyb1 complexed with eph, f3s, fad, fes, hem, mli, rqx, sf4 |
PDB Entry: 3vr8 (more details), 2.81 Å
SCOPe Domain Sequences for d3vr8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr8b1 d.15.4.0 (B:33-138) automated matches {Pig roundworm (Ascaris suum) [TaxId: 6253]} kriktfeiyrfnpeepgakpklqkfdvdldkcgtmvldalikiknevdptltfrrscreg icgscamniagentlacicnidqntskttkiyplphmfvikdlvpd
Timeline for d3vr8b1: