| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
| Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries) |
| Domain d3vonw_: 3von W: [250647] Other proteins in same PDB: d3vona_, d3vonc_, d3vone_, d3vong_, d3vonh_, d3vonj_, d3vonl_, d3vonn_, d3vono_, d3vonq_, d3vons_, d3vonu_, d3vonv_, d3vonx_, d3vonz_ automated match to d1j7da_ |
PDB Entry: 3von (more details), 3.15 Å
SCOPe Domain Sequences for d3vonw_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vonw_ d.20.1.1 (W:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
mskenmklpqppegqty
Timeline for d3vonw_: