Lineage for d3vonw_ (3von W:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642814Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1642878Species Human (Homo sapiens), mms2 [TaxId:9606] [64242] (6 PDB entries)
  8. 1642892Domain d3vonw_: 3von W: [250647]
    Other proteins in same PDB: d3vona_, d3vonc_, d3vone_, d3vong_, d3vonh_, d3vonj_, d3vonl_, d3vonn_, d3vono_, d3vonq_, d3vons_, d3vonu_, d3vonv_, d3vonx_, d3vonz_
    automated match to d1j7da_

Details for d3vonw_

PDB Entry: 3von (more details), 3.15 Å

PDB Description: Crystalstructure of the ubiquitin protease
PDB Compounds: (W:) Ubiquitin-conjugating enzyme E2 variant 2

SCOPe Domain Sequences for d3vonw_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vonw_ d.20.1.1 (W:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), mms2 [TaxId: 9606]}
vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmiigpprtnyenriyslk
vecgpkypeappsvrfvtkinmnginnssgmvdarsipvlakwqnsysikvvlqelrrlm
mskenmklpqppegqty

SCOPe Domain Coordinates for d3vonw_:

Click to download the PDB-style file with coordinates for d3vonw_.
(The format of our PDB-style files is described here.)

Timeline for d3vonw_: