Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries) |
Domain d3vons_: 3von S: [250643] Other proteins in same PDB: d3vona_, d3vonb_, d3vond_, d3vonf_, d3vonh_, d3voni_, d3vonk_, d3vonm_, d3vono_, d3vonp_, d3vonr_, d3vont_, d3vonv_, d3vonw_, d3vony_ automated match to d2c2vb_ |
PDB Entry: 3von (more details), 3.15 Å
SCOPe Domain Sequences for d3vons_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vons_ d.20.1.1 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]} glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla ndvaeqwktneaqaietarawtrlyamn
Timeline for d3vons_: