Lineage for d3vons_ (3von S:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1642804Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1642805Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1642806Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1642988Protein automated matches [190124] (12 species)
    not a true protein
  7. 1642998Species Human (Homo sapiens) [TaxId:9606] [186848] (29 PDB entries)
  8. 1643052Domain d3vons_: 3von S: [250643]
    Other proteins in same PDB: d3vona_, d3vonb_, d3vond_, d3vonf_, d3vonh_, d3voni_, d3vonk_, d3vonm_, d3vono_, d3vonp_, d3vonr_, d3vont_, d3vonv_, d3vonw_, d3vony_
    automated match to d2c2vb_

Details for d3vons_

PDB Entry: 3von (more details), 3.15 Å

PDB Description: Crystalstructure of the ubiquitin protease
PDB Compounds: (S:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d3vons_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vons_ d.20.1.1 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamn

SCOPe Domain Coordinates for d3vons_:

Click to download the PDB-style file with coordinates for d3vons_.
(The format of our PDB-style files is described here.)

Timeline for d3vons_: