Lineage for d3vono_ (3von O:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1634067Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1634068Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1634821Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 1634822Protein automated matches [190230] (16 species)
    not a true protein
  7. 1634834Species Human (Homo sapiens) [TaxId:9606] [187072] (30 PDB entries)
  8. 1634893Domain d3vono_: 3von O: [250639]
    Other proteins in same PDB: d3vonb_, d3vonc_, d3vond_, d3vone_, d3vonf_, d3vong_, d3voni_, d3vonj_, d3vonk_, d3vonl_, d3vonm_, d3vonn_, d3vonp_, d3vonq_, d3vonr_, d3vons_, d3vont_, d3vonu_, d3vonw_, d3vonx_, d3vony_, d3vonz_
    automated match to d4i6la_

Details for d3vono_

PDB Entry: 3von (more details), 3.15 Å

PDB Description: Crystalstructure of the ubiquitin protease
PDB Compounds: (O:) Ubiquitin thioesterase OTUB1

SCOPe Domain Sequences for d3vono_:

Sequence, based on SEQRES records: (download)

>d3vono_ d.3.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaeddniyqqkikdlhkkysyirktrpdgncfyrafgfshleal
lddskelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfnd
qstsdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiiala
qalsvsiqveymdrgeggttnphifpegsepkvyllyrpghydilyk

Sequence, based on observed residues (ATOM records): (download)

>d3vono_ d.3.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nplvserlelsvlykeyaniyqqkikdlhkkysyirktrpdgncfyrafgfshlealldd
skelqrfkavsakskedlvsqgfteftiedfhntfmdlieqvekqtsvadllasfndqst
sdylvvylrlltsgylqreskffehfieggrtvkefcqqevepmckesdhihiialaqal
svsiqveymdphifpegsepkvyllyrpghydilyk

SCOPe Domain Coordinates for d3vono_:

Click to download the PDB-style file with coordinates for d3vono_.
(The format of our PDB-style files is described here.)

Timeline for d3vono_: