Lineage for d3vomb_ (3vom B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2897573Species Mycobacterium tuberculosis [TaxId:83332] [187938] (15 PDB entries)
  8. 2897605Domain d3vomb_: 3vom B: [250624]
    automated match to d2fyfa_
    complexed with gol, plp, so4

Details for d3vomb_

PDB Entry: 3vom (more details), 2.1 Å

PDB Description: structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis
PDB Compounds: (B:) Putative phosphoserine aminotransferase

SCOPe Domain Sequences for d3vomb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vomb_ c.67.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
leiptaikprdgrfgsgpskvrleqlqtltttaaalfgtshrqapvknlvgrvrsglael
fslpdgyevilgnggatafwdaaafglidkrslhltygefsakfasavsknpfvgepiii
tsdpgsapepqtdpsvdviawahnetstgvavavrrpegsddalvvidatsgagglpvdi
aetdayyfapqknfasdgglwlaimspaalsrieaiaatgrwvpdflslpiavenslknq
tyntpaiatlallaeqidwlvgnggldwavkrtadssqrlyswaqerpyttpfvtdpglr
sqvvgtidfvddvdagtvakilrangivdtepyrklgrnqlrvamfpavepddvsaltec
vdwvverl

SCOPe Domain Coordinates for d3vomb_:

Click to download the PDB-style file with coordinates for d3vomb_.
(The format of our PDB-style files is described here.)

Timeline for d3vomb_: