Lineage for d3vofa_ (3vof A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1582839Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1582840Superfamily c.6.1: Glycosyl hydrolases family 6, cellulases [51989] (2 families) (S)
  5. 1582906Family c.6.1.0: automated matches [195757] (1 protein)
    not a true family
  6. 1582907Protein automated matches [195758] (1 species)
    not a true protein
  7. 1582908Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [195759] (8 PDB entries)
  8. 1582913Domain d3vofa_: 3vof A: [250622]
    automated match to d1hgwa_
    complexed with bgc; mutant

Details for d3vofa_

PDB Entry: 3vof (more details), 1.6 Å

PDB Description: cellobiohydrolase mutant, cccel6c d102a, in the closed form
PDB Compounds: (A:) cellobiohydrolase

SCOPe Domain Sequences for d3vofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vofa_ c.6.1.0 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
svnpyigrsplviksyaekleetiayfeaqgdelnaartrtvqgiptfawisdsatidti
qpliadavahqeasgeqvlvqlviynlpdracaakasdgefhldddgankyrayvdriva
elstadadklhfsivlepdslgnmvtnmhvpkcqgaataykegiaytiaslqkpnidlyi
daahggwlgwndnlrpsaeifketldlarqitpnatvrglainvsnynpyktraredyte
wnnaydewnyvktltphlqavgfpaqfivdqgrsgregirtewgqwcnirnagfgirptt
dqaivdsanvdaivwvkpggesdgtsdvnavrfdencrspashvpapeagewfnefvvnl
vinanpplepty

SCOPe Domain Coordinates for d3vofa_:

Click to download the PDB-style file with coordinates for d3vofa_.
(The format of our PDB-style files is described here.)

Timeline for d3vofa_: