SCOPe 2.08: Domain d3vm1a2: 3vm1 A:175-345

Lineage for d3vm1a2 (3vm1 A:175-345)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families)
   duplication: contains two domains of this fold

5. Family d.134.1.0: automated matches [254284] (1 protein)
   not a true family

6. Protein automated matches [254663] (3 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255758] (16 PDB entries)

8. Domain d3vm1a2: 3vm1 A:175-345 [250613]
   Other proteins in same PDB: d3vm1a1, d3vm1a3
   automated match to d2akja4
   complexed with bct, cl, k, sf4, srm; mutant

Details for d3vm1a2

PDB Entry: 3vm1, 1.5 Å

PDB Description: assimilatory nitrite reductase (Nii3) - N226K mutant - HCO3 complex from tobacco leaf

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3vm1a2:

Sequence; same for both SEQRES and ATOM records:

>d3vm1a2 d.134.1.0 (A:175-345) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
mdnvrnpvgnplagidpeeivdtrpytnllsqfitgnsrgnpavsnlprkwkpcvvgshd
lyehphindlaympatkdgrfgfnllvggffsakrcdeaipldawvpaddvvpvcraile
afrdlgfrgnrqkcrmmwlidelgvegfraevekrmpqqqleraspedlvq

Timeline for d3vm1a2:

• d3vm1a2 first appeared in SCOPe 2.04
  
• d3vm1a2 appears in SCOPe 2.07