Lineage for d3vm0a4 (3vm0 A:430-555)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977743Family d.134.1.0: automated matches [254284] (1 protein)
    not a true family
  6. 2977744Protein automated matches [254663] (3 species)
    not a true protein
  7. 2977761Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255758] (16 PDB entries)
  8. 2977783Domain d3vm0a4: 3vm0 A:430-555 [250611]
    Other proteins in same PDB: d3vm0a1, d3vm0a3
    automated match to d2akja3
    complexed with cl, k, no2, sf4, srm; mutant

Details for d3vm0a4

PDB Entry: 3vm0 (more details), 1.7 Å

PDB Description: Assimilatory nitrite reductase (Nii3) - N226K mutant - NO2 complex from tobacco leaf
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3vm0a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vm0a4 d.134.1.0 (A:430-555) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ppilmkglvactgnqfcgqaiietkarslkiteevqrqvsltkpvrmhwtgcpntcaqvq
vadigfmgcltrdkngktvegadvflggrigsdshlgevykkavpcddlvplvvdllvnn
fgavpr

SCOPe Domain Coordinates for d3vm0a4:

Click to download the PDB-style file with coordinates for d3vm0a4.
(The format of our PDB-style files is described here.)

Timeline for d3vm0a4: