Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) duplication: contains two subdomains of this fold |
Family d.58.36.0: automated matches [254283] (1 protein) not a true family |
Protein automated matches [254662] (3 species) not a true protein |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255757] (16 PDB entries) |
Domain d3vm0a3: 3vm0 A:346-429 [250610] Other proteins in same PDB: d3vm0a2, d3vm0a4 automated match to d2akja1 complexed with cl, k, no2, sf4, srm; mutant |
PDB Entry: 3vm0 (more details), 1.7 Å
SCOPe Domain Sequences for d3vm0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vm0a3 d.58.36.0 (A:346-429) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} kqwerrdylgvhpqkqegysfiglhipvgrvqaddmdelarladeygsgeirltveqnii ipnietskieallkepvlstfspd
Timeline for d3vm0a3: