Lineage for d3vlza3 (3vlz A:346-429)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1654893Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 1654978Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 1654979Protein automated matches [254662] (2 species)
    not a true protein
  7. 1654987Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255757] (16 PDB entries)
  8. 1655017Domain d3vlza3: 3vlz A:346-429 [250606]
    Other proteins in same PDB: d3vlza2, d3vlza4
    automated match to d2akja1
    complexed with cl, k, sf4, so3, srm; mutant

Details for d3vlza3

PDB Entry: 3vlz (more details), 2.07 Å

PDB Description: Assimilatory nitrite reductase (Nii3) - N226K mutant - SO3 full complex from tobacco leaf
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3vlza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlza3 d.58.36.0 (A:346-429) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
kqwerrdylgvhpqkqegysfiglhipvgrvqaddmdelarladeygsgeirltveqnii
ipnietskieallkepvlstfspd

SCOPe Domain Coordinates for d3vlza3:

Click to download the PDB-style file with coordinates for d3vlza3.
(The format of our PDB-style files is described here.)

Timeline for d3vlza3: