![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily) beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2 |
![]() | Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) ![]() duplication: contains two domains of this fold |
![]() | Family d.134.1.0: automated matches [254284] (1 protein) not a true family |
![]() | Protein automated matches [254663] (3 species) not a true protein |
![]() | Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255758] (16 PDB entries) |
![]() | Domain d3vlya2: 3vly A:175-345 [250601] Other proteins in same PDB: d3vlya1, d3vlya3 automated match to d2akja4 complexed with cl, k, sf4, so3, srm; mutant |
PDB Entry: 3vly (more details), 1.55 Å
SCOPe Domain Sequences for d3vlya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vlya2 d.134.1.0 (A:175-345) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} mdnvrnpvgnplagidpeeivdtrpytnllsqfitgnsrgnpavsnlprkwkpcvvgshd lyehphindlaympatkdgrfgfnllvggffsakrcdeaipldawvpaddvvpvcraile afrdlgfrgnrqkcrmmwlidelgvegfraevekrmpqqqleraspedlvq
Timeline for d3vlya2: