Lineage for d3vlxa1 (3vlx A:18-174)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955515Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 2955516Protein automated matches [254662] (3 species)
    not a true protein
  7. 2955533Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255757] (16 PDB entries)
  8. 2955538Domain d3vlxa1: 3vlx A:18-174 [250596]
    Other proteins in same PDB: d3vlxa2, d3vlxa4
    automated match to d2akja2
    complexed with cl, k, sf4, srm; mutant

Details for d3vlxa1

PDB Entry: 3vlx (more details), 1.35 Å

PDB Description: Assimilatory nitrite reductase (Nii3) - N226K mutant - ligand free form from tobacco leaf
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3vlxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlxa1 d.58.36.0 (A:18-174) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
vaaerleprveekdgywilkeqfrkginpqekvkiekepmklfmengieelakipieeid
qskltkddidvrlkwlglfhrrknqygrfmmrlklpngvttsaqtrylasvirkygkegc
adittrqnwqirgvvlpdvpeilkglaevgltslqsg

SCOPe Domain Coordinates for d3vlxa1:

Click to download the PDB-style file with coordinates for d3vlxa1.
(The format of our PDB-style files is described here.)

Timeline for d3vlxa1: