SCOP 1.73: Domain d1cqfe_: 1cqf E:

Lineage for d1cqfe_ (1cqf E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.40: OB-fold [50198] (12 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)

6. Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
   phage-borne toxin; bacteriophages H30 and H19B

7. Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)

8. Domain d1cqfe_: 1cqf E: [25059]
   complex with Gb3 trisaccharide
   complexed with gal, glc; mutant

Details for d1cqfe_

PDB Entry: 1cqf, 2.2 Å

PDB Description: the complex of the mutated shiga toxin b subunit and gb3 trisaccharide

PDB Compounds: (E:) shiga toxin b-chain

SCOP Domain Sequences for d1cqfe_:

Sequence; same for both SEQRES and ATOM records:

>d1cqfe_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

Timeline for d1cqfe_:

• d1cqfe_ first appeared (with stable ids) in SCOP 1.55
  
• d1cqfe_ appears in SCOP 1.71
  
• d1cqfe_ appears in SCOP 1.75
  
• d1cqfe_ appears in the current release, SCOPe 2.08