Lineage for d3vkqa1 (3vkq A:18-174)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955515Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 2955516Protein automated matches [254662] (3 species)
    not a true protein
  7. 2955533Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255757] (16 PDB entries)
  8. 2955550Domain d3vkqa1: 3vkq A:18-174 [250580]
    Other proteins in same PDB: d3vkqa2, d3vkqa4
    automated match to d2akja2
    complexed with cl, k, no2, sf4, srm

Details for d3vkqa1

PDB Entry: 3vkq (more details), 1.6 Å

PDB Description: Assimilatory nitrite reductase (Nii3) - NO2 complex from tobbaco leaf analysed with middle X-ray dose
PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3vkqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vkqa1 d.58.36.0 (A:18-174) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
vaaerleprveekdgywilkeqfrkginpqekvkiekepmklfmengieelakipieeid
qskltkddidvrlkwlglfhrrknqygrfmmrlklpngvttsaqtrylasvirkygkegc
adittrqnwqirgvvlpdvpeilkglaevgltslqsg

SCOPe Domain Coordinates for d3vkqa1:

Click to download the PDB-style file with coordinates for d3vkqa1.
(The format of our PDB-style files is described here.)

Timeline for d3vkqa1: