SCOPe 2.08: Domain d3vkpa2: 3vkp A:175-345

Lineage for d3vkpa2 (3vkp A:175-345)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families)
   duplication: contains two domains of this fold

5. Family d.134.1.0: automated matches [254284] (1 protein)
   not a true family

6. Protein automated matches [254663] (3 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [255758] (16 PDB entries)

8. Domain d3vkpa2: 3vkp A:175-345 [250577]
   Other proteins in same PDB: d3vkpa1, d3vkpa3
   automated match to d2akja4
   complexed with cl, k, no2, sf4, srm

Details for d3vkpa2

PDB Entry: 3vkp, 1.4 Å

PDB Description: Assimilatory nitrite reductase (Nii3) - NO2 complex from tobbaco leaf analysed with low X-ray dose

PDB Compounds: (A:) nitrite reductase

SCOPe Domain Sequences for d3vkpa2:

Sequence; same for both SEQRES and ATOM records:

>d3vkpa2 d.134.1.0 (A:175-345) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
mdnvrnpvgnplagidpeeivdtrpytnllsqfitgnsrgnpavsnlprkwnpcvvgshd
lyehphindlaympatkdgrfgfnllvggffsakrcdeaipldawvpaddvvpvcraile
afrdlgfrgnrqkcrmmwlidelgvegfraevekrmpqqqleraspedlvq

Timeline for d3vkpa2:

• d3vkpa2 first appeared in SCOPe 2.04
  
• d3vkpa2 appears in SCOPe 2.07