| Class b: All beta proteins [48724] (178 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (66 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries) |
| Domain d3vkma2: 3vkm A:155-317 [250573] automated match to d3ap6d_ complexed with bgc, edo, gal, sia; mutant |
PDB Entry: 3vkm (more details), 2.98 Å
SCOPe Domain Sequences for d3vkma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vkma2 b.29.1.0 (A:155-317) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmrlpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafv
rnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssi
dtleingdihllevrsw
Timeline for d3vkma2: