| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
| Protein automated matches [190907] (21 species) not a true protein |
| Species Neisseria meningitidis [TaxId:122586] [256137] (1 PDB entry) |
| Domain d3vk0c_: 3vk0 C: [250567] automated match to d2b5ad_ |
PDB Entry: 3vk0 (more details), 1.88 Å
SCOPe Domain Sequences for d3vk0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vk0c_ a.35.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 122586]}
kltlpaelpdeqdlravlaynmrlfrvnkgwsqeelarqcgldrtyvsaverkrwnials
niekmaaalgvaayqlllppqerlklmt
Timeline for d3vk0c_: