![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
![]() | Protein automated matches [190907] (21 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [256137] (1 PDB entry) |
![]() | Domain d3vk0a_: 3vk0 A: [250565] automated match to d2b5ad_ |
PDB Entry: 3vk0 (more details), 1.88 Å
SCOPe Domain Sequences for d3vk0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vk0a_ a.35.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]} kltlpaelpdeqdlravlaynmrlfrvnkgwsqeelarqcgldrtyvsaverkrwnials niekmaaalgvaayqlllppqerlklmtn
Timeline for d3vk0a_: