Lineage for d3vk0a_ (3vk0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709861Species Neisseria meningitidis [TaxId:122586] [256137] (1 PDB entry)
  8. 2709862Domain d3vk0a_: 3vk0 A: [250565]
    automated match to d2b5ad_

Details for d3vk0a_

PDB Entry: 3vk0 (more details), 1.88 Å

PDB Description: crystal structure of hypothetical transcription factor nhtf from neisseria
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d3vk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk0a_ a.35.1.0 (A:) automated matches {Neisseria meningitidis [TaxId: 122586]}
kltlpaelpdeqdlravlaynmrlfrvnkgwsqeelarqcgldrtyvsaverkrwnials
niekmaaalgvaayqlllppqerlklmtn

SCOPe Domain Coordinates for d3vk0a_:

Click to download the PDB-style file with coordinates for d3vk0a_.
(The format of our PDB-style files is described here.)

Timeline for d3vk0a_: