SCOPe 2.05: Domain d3visb_: 3vis B:

Lineage for d3visb_ (3vis B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.16: Lipase [53555] (2 proteins)

6. Protein automated matches [254730] (3 species)
   not a true protein

7. Species Thermobifida alba [TaxId:53522] [256136] (2 PDB entries)

8. Domain d3visb_: 3vis B: [250564]
   automated match to d1jfra_
   complexed with pe4

Details for d3visb_

PDB Entry: 3vis, 1.76 Å

PDB Description: Crystal structure of cutinase Est119 from Thermobifida alba AHK119

PDB Compounds: (B:) esterase

SCOPe Domain Sequences for d3visb_:

Sequence; same for both SEQRES and ATOM records:

>d3visb_ c.69.1.16 (B:) automated matches {Thermobifida alba [TaxId: 53522]}
anpyergpnptesmlearsgpfsvseerasrfgadgfgggtiyyprenntygaiaispgy
tgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaaldymltdassavrnrid
asrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrditvptliigaeydtias
vtlhskpfynsipsptdkayleldgashfapnitnktigmysvawlkrfvdedtrytqfl
cpgprtgllsdveeyrstcpf

Timeline for d3visb_:

• d3visb_ first appeared in SCOPe 2.04
  
• d3visb_ appears in SCOPe 2.06
  
• d3visb_ appears in the current release, SCOPe 2.08