Lineage for d3visa_ (3vis A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135079Family c.69.1.16: Lipase [53555] (2 protein domains)
  6. 2135084Protein automated matches [254730] (4 species)
    not a true protein
  7. 2135089Species Thermobifida alba [TaxId:53522] [256136] (2 PDB entries)
  8. 2135090Domain d3visa_: 3vis A: [250563]
    automated match to d1jfra_
    complexed with pe4

Details for d3visa_

PDB Entry: 3vis (more details), 1.76 Å

PDB Description: Crystal structure of cutinase Est119 from Thermobifida alba AHK119
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d3visa_:

Sequence, based on SEQRES records: (download)

>d3visa_ c.69.1.16 (A:) automated matches {Thermobifida alba [TaxId: 53522]}
qaanpyergpnptesmlearsgpfsvseerasrfgadgfgggtiyyprenntygaiaisp
gytgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaaldymltdassavrnr
idasrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrditvptliigaeydti
asvtlhskpfynsipsptdkayleldgashfapnitnktigmysvawlkrfvdedtrytq
flcpgprtgllsdveeyrstcpf

Sequence, based on observed residues (ATOM records): (download)

>d3visa_ c.69.1.16 (A:) automated matches {Thermobifida alba [TaxId: 53522]}
qaanpyergpnptesmlearsgpfsvseerasrfgadgfgggtiyyprenntygaiaisp
gytgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaaldymltdassavrnr
idasrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrditvptliigaeydti
asvtlhskpfynsipsptdkayleldgashfapnitnktigmysvawlkrfvdedtrytq
flcpgprtlsdveeyrstcpf

SCOPe Domain Coordinates for d3visa_:

Click to download the PDB-style file with coordinates for d3visa_.
(The format of our PDB-style files is described here.)

Timeline for d3visa_: