Lineage for d3vgoa3 (3vgo A:256-339)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1661863Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1661864Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1662297Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 1662298Protein automated matches [190561] (3 species)
    not a true protein
  7. 1662299Species Human (Homo sapiens) [TaxId:9606] [187549] (38 PDB entries)
  8. 1662347Domain d3vgoa3: 3vgo A:256-339 [250561]
    Other proteins in same PDB: d3vgoa1, d3vgoa2
    automated match to d1b47a3

Details for d3vgoa3

PDB Entry: 3vgo (more details), 3.1 Å

PDB Description: Crystal structure of the N-terminal fragment of Cbl-b
PDB Compounds: (A:) E3 ubiquitin-protein ligase CBL-B

SCOPe Domain Sequences for d3vgoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vgoa3 d.93.1.0 (A:256-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thpgymafltydevkarlqkystkpgsyifrlsctrlgqwaigyvtgdgnilqtiphnkp
lfqalidgsregfylypdgrsynp

SCOPe Domain Coordinates for d3vgoa3:

Click to download the PDB-style file with coordinates for d3vgoa3.
(The format of our PDB-style files is described here.)

Timeline for d3vgoa3: