Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
Protein automated matches [190561] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries) |
Domain d3vgoa3: 3vgo A:256-339 [250561] Other proteins in same PDB: d3vgoa1, d3vgoa2 automated match to d1b47a3 |
PDB Entry: 3vgo (more details), 3.1 Å
SCOPe Domain Sequences for d3vgoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgoa3 d.93.1.0 (A:256-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} thpgymafltydevkarlqkystkpgsyifrlsctrlgqwaigyvtgdgnilqtiphnkp lfqalidgsregfylypdgrsynp
Timeline for d3vgoa3: