Lineage for d3vgoa1 (3vgo A:43-169)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714566Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2714567Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) (S)
    automatically mapped to Pfam PF02262
  5. 2714593Family a.48.1.0: automated matches [254318] (1 protein)
    not a true family
  6. 2714594Protein automated matches [254729] (1 species)
    not a true protein
  7. 2714595Species Human (Homo sapiens) [TaxId:9606] [256135] (2 PDB entries)
  8. 2714597Domain d3vgoa1: 3vgo A:43-169 [250559]
    Other proteins in same PDB: d3vgoa2, d3vgoa3
    automated match to d2cbla2

Details for d3vgoa1

PDB Entry: 3vgo (more details), 3.1 Å

PDB Description: Crystal structure of the N-terminal fragment of Cbl-b
PDB Compounds: (A:) E3 ubiquitin-protein ligase CBL-B

SCOPe Domain Sequences for d3vgoa1:

Sequence, based on SEQRES records: (download)

>d3vgoa1 a.48.1.0 (A:43-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvektwklmdkvvrlcqnpklqlknsppyildilpdtyqhlrlilskyddnqklaqls
eneyfkiyidslmkkskrairlfkegkermyeeqsqdrrnltklslifshmlaeikaifp
ngqfqgd

Sequence, based on observed residues (ATOM records): (download)

>d3vgoa1 a.48.1.0 (A:43-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrtvektwklmdkvvrlcqnpklqlknsppyildilpdtyqhlrlilskyaqlseneyfk
iyidslmkkskrairlfkegkermyqdrrnltklslifshmlaeikaifpngqfqgd

SCOPe Domain Coordinates for d3vgoa1:

Click to download the PDB-style file with coordinates for d3vgoa1.
(The format of our PDB-style files is described here.)

Timeline for d3vgoa1: