SCOPe 2.05: Domain d3vgha1: 3vgh A:4-90

Lineage for d3vgha1 (3vgh A:4-90)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species)
   domain architecture similar to isoamylase

7. Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (8 PDB entries)

8. Domain d3vgha1: 3vgh A:4-90 [250556]
   Other proteins in same PDB: d3vgha2, d3vgha3
   automated match to d1eh9a1
   complexed with flc, gol

Details for d3vgha1

PDB Entry: 3vgh, 2.6 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase (e283q) complexed with maltotriosyltrehalose

PDB Compounds: (A:) Malto-oligosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d3vgha1:

Sequence; same for both SEQRES and ATOM records:

>d3vgha1 b.1.18.2 (A:4-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Sulfolobus solfataricus, km1 [TaxId: 2287]}
ykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldda
seipdpasryqpegvhgpsqiiqeske

Timeline for d3vgha1:

• d3vgha1 first appeared in SCOPe 2.04
  
• d3vgha1 appears in SCOPe 2.06
  
• d3vgha1 appears in the current release, SCOPe 2.08