Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Glycosyltrehalose trehalohydrolase, N-terminal domain N [49224] (2 species) domain architecture similar to isoamylase |
Species Sulfolobus solfataricus, km1 [TaxId:2287] [49225] (8 PDB entries) |
Domain d3vgha1: 3vgh A:4-90 [250556] Other proteins in same PDB: d3vgha2, d3vgha3 automated match to d1eh9a1 complexed with flc, gol |
PDB Entry: 3vgh (more details), 2.6 Å
SCOPe Domain Sequences for d3vgha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vgha1 b.1.18.2 (A:4-90) Glycosyltrehalose trehalohydrolase, N-terminal domain N {Sulfolobus solfataricus, km1 [TaxId: 2287]} ykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvldda seipdpasryqpegvhgpsqiiqeske
Timeline for d3vgha1: